- ANAPC16 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89048
- Unconjugated
- ANAPC16
- PBS (pH 7.2) and 40% Glycerol
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- bA570G20.3, MSAG, C10orf104, APC16, CENP-27
- 0.1 ml (also 25ul)
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: VSGSSVTGSG FSVSDLAPPR KALFTYPKGA GEMLEDGSER FLCESVFSYQ VASTLKQVKH DQQVARMEKL AGLVEELEAD EWRFKPIEQ
- Human
- anaphase promoting complex subunit 16
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
VSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQ
Specifications/Features
Available conjugates: Unconjugated